Protein or peptide name:	AcrZ
Chromosome:	K-12 substr. MG1655, complete genome
Protein or peptide start site:	794773
Protein or peptide end site:	794922
ncRNA start site:	794773
ncRNA end site:	794922
Genome Browser:	NA
Protein or peptide sequence:	MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH
Protein or peptide length:	49aa
ncRNA type:	ncRNA
ncRNA name:	acrZ
Entrez ID:	945365
Experimental species:	Escherichia coli
Experimental techniques:	Western blotting
Experimental sample (cell line and/or tissue):	E. coli
Description:	Here we show that AcrZ (formerly named YbhT), a 49-amino-acid inner membrane protein, associates with the AcrAB-TolC complex.
Subcellular location:	inner membrane
Function:	AcrZ may enhance the ability of the AcrAB-TolC pump to export certain classes of substrates.
Title of paper:	Conserved small protein associates with the multidrug efflux pump AcrB and differentially affects antibiotic resistance
PMID:	23010927
Year of publication:	2012